HPA026697

UHRF2 antibody from Sigma-Aldrich
MGC33463, NIRF, RNF107, TDRD23, URF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026697
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026697, RRID:AB_1858611
Product name
Anti-UHRF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026697
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase UHRF2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAFQLTPQQQHLIREDCQNQKLWDEVLSHLVEGPN
FLKKLEQSFMCVCCQELVYQPVTTECFHNVCK
Storage
-20C
Provider Type Product Number
- No reagents -