Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [10]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90667 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90667, RRID:AB_2665627
- Product name
- Anti-PODXL
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKC
EDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISL
ICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEIT
IHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD- Epitope
- Binds to an epitope located within the peptide sequence IHTKLPAKDVYERLK as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0308
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer
Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
Boman K, Larsson A, Segersten U, Kuteeva E, Johannesson H, Nodin B, Eberhard J, Uhlén M, Malmström P, Jirström K
British Journal of Cancer 2013 May;108(11):2321-2328
British Journal of Cancer 2013 May;108(11):2321-2328
Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
Boman K, Larsson AH, Segersten U, Kuteeva E, Johannesson H, Nodin B, Eberhard J, Uhlén M, Malmström PU, Jirström K
British journal of cancer 2013 Jun 11;108(11):2321-8
British journal of cancer 2013 Jun 11;108(11):2321-8
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and liver tissues using AMAb90667 antibody. Corresponding PODXL RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in renal glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong immunoreactivity in the endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal tumour shows strong membranous, combined with moderate cytoplasmic, immunoreactivity in tumour cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal tumour shows moderate cytoplasmic immunoreactivity in tumour cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal tumour shows negative tumour cells and positive stromal vessels.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate positivity in apical membranes of glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows weak to moderate membranous positivity in endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.