HPA002110

PODXL antibody from Sigma-Aldrich
Gp200, PC, PCLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002110
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002110, RRID:AB_1855512
Product name
Anti-PODXL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002110
Antibody type
Polyclonal
Antigen
Podocalyxin-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKC
EDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISL
ICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEIT
IHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
Storage
-20C
Provider Type Product Number
- No reagents -