HPA002318

GLDC antibody from Sigma-Aldrich
GCSP, NKH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002318, RRID:AB_1849700
Product name
Anti-GLDC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002318
Antibody type
Polyclonal
Antigen
Glycine dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILNANYMAKRLETHYRILFRGARGYVGHEFILDTR
PFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTL
MVEPTESEDKAELDRFCDAMISIRQEIADIEEGRI
DPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPL
PFVKPENK
Storage
-20C
Provider Type Product Number
- No reagents -