H00008793-A01

TNFRSF10D antibody from Abnova Corporation
CD264, DcR2, TRAILR4, TRUNDD
No application information provided.

Antibody data

Product number
H00008793-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008793-A01, RRID:AB_461983
Product name
TNFRSF10D polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00008793-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant TNFRSF10D.
Antigen sequence
ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRS
EYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQ
TNKSSCTTTRDTVCQCEKGS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -