HPA002924

CDKN1C antibody from Atlas Antibodies
BWCR, BWS, KIP2, P57

Antibody data

Product number
HPA002924
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002924, RRID:AB_1079548
Product name
Anti-CDKN1C
Provider product page
Atlas Antibodies - HPA002924
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRE
LQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWT
EVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAV
SPPLEPAAESLDGLEEAPEQLPSVPVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.