HPA002924

CDKN1C antibody from Sigma-Aldrich
BWCR, BWS, KIP2, P57
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002924, RRID:AB_1079548
Product name
Anti-CDKN1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002924
Antibody type
Polyclonal
Antigen
Cyclin-dependent kinase inhibitor 1C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRE
LQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWT
EVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAV
SPPLEPAAESLDGLEEAPEQLPSVPVP
Storage
-20C
Provider Type Product Number
- No reagents -