H00005205-M02

ATP8B1 antibody from Abnova Corporation
ATPIC, BRIC, FIC1, PFIC, PFIC1

Antibody data

Product number
H00005205-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005205-M02, RRID:AB_1671467
Product name
ATP8B1 monoclonal antibody (M02), clone 3F10
Provider product page
Abnova Corporation - H00005205-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ATP8B1.
Antigen sequence
INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKL
AFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVD
RTDGQLNYQAA
Isotype
IgG
Antibody clone number
3F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.