HPA018674

ATP8B1 antibody from Sigma-Aldrich
ATPIC, BRIC, FIC1, PFIC, PFIC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018674
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018674, RRID:AB_1845208
Product name
Anti-ATP8B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018674
Antibody type
Polyclonal
Antigen
Probable phospholipid-transporting ATPase IC recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KIWVLTGDKKETAENIGFACELLTEDTTICYGEDI
NSLLHARMENQRNRGGVYAKFAPPVQESFFPPGGN
RALII
Storage
-20C
Provider Type Product Number
- No reagents -