HPA018673

ATP8B1 antibody from Atlas Antibodies
ATPIC, BRIC, FIC1, PFIC, PFIC1

Antibody data

Product number
HPA018673
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018673, RRID:AB_1845207
Product name
Anti-ATP8B1
Provider product page
Atlas Antibodies - HPA018673
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTFDEDSQPNDEVVPYSDDETEDELDDQGSAVEPE
QNRVNREAEENREPFRKECTWQVKANDRKYHEQPH
FMNTKFLCIKESKYANNAIKTYKYNAFTFIPMNLF
EQF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.