HPA018673

ATP8B1 antibody from Atlas Antibodies
ATPIC, BRIC, FIC1, PFIC, PFIC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018673
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018673, RRID:AB_1845207
Product name
Anti-ATP8B1
Provider product page
Atlas Antibodies - HPA018673
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTFDEDSQPNDEVVPYSDDETEDELDDQGSAVEPE
QNRVNREAEENREPFRKECTWQVKANDRKYHEQPH
FMNTKFLCIKESKYANNAIKTYKYNAFTFIPMNLF
EQF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -