Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023677 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023677, RRID:AB_1848440
- Product name
- Anti-FBF1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQA
LLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGK
GELPNHP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles.
The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms.
Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods
Kong D, Farmer V, Shukla A, James J, Gruskin R, Kiriyama S, Loncarek J
The Journal of cell biology 2014 Sep 29;206(7):855-65
The Journal of cell biology 2014 Sep 29;206(7):855-65
The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms.
Jodoin JN, Shboul M, Albrecht TR, Lee E, Wagner EJ, Reversade B, Lee LA
Biology open 2013 Dec 15;2(12):1390-6
Biology open 2013 Dec 15;2(12):1390-6
Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods
Jakobsen L, Vanselow K, Skogs M, Toyoda Y, Lundberg E, Poser I, Falkenby L, Bennetzen M, Westendorf J, Nigg E, Uhlen M, Hyman A, Andersen J
The EMBO Journal 2011 April;30(8):1520-1535
The EMBO Journal 2011 April;30(8):1520-1535
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A549 shows localization to centrosome.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows weak membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Sample type
- HUMAN