HPA002279

PLVAP antibody from Sigma-Aldrich
FELS, gp68, PV-1, PV1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002279
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002279, RRID:AB_1079636
Product name
Anti-PLVAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002279
Antibody type
Polyclonal
Antigen
Plasmalemma vesicle-associated protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRS
LDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVE
ELARSLRADIERVARENSDLQRQKLEAQQGLRASQ
EAKQKVEKEAQAREAKLQAECSR
Storage
-20C
Provider Type Product Number
- No reagents -