HPA022786

GUCD1 antibody from Sigma-Aldrich
C22orf13, LLN4, MGC1842
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022786
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022786, RRID:AB_1845711
Product name
Anti-C22orf13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022786
Antibody type
Polyclonal
Antigen
Uncharacterized protein C22orf13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEE
TRVNQLFAQAKACKVLVEKCTVSVKDIQAHLAQGH
VAIVLVNSGVLHCDLCS
Storage
-20C
Provider Type Product Number
- No reagents -