HPA001874

ODF2 antibody from Sigma-Aldrich
CT134, ODF84
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001874
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001874, RRID:AB_1079522
Product name
Anti-ODF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001874
Antibody type
Polyclonal
Antigen
outer dense fiber of sperm tails 2 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSE
KLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMN
AVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAH
ELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQ
EKE
Storage
-20C
Provider Type Product Number
- No reagents -