ABIN631233

antibody from antibodies-online

Targeting: MTMR12 3-PAP, 3PAP, FLJ20476, KIAA1682, PIP3AP

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631233 - Provider product page
Provider: antibodies-online
Product name: anti-Myotubularin Related Protein 12 (MTMR12) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD
Description: Affinity purified
Reactivity: Human, Mouse
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MTMR12 protein structure - ABIN631233 shown in red.