ABIN503906
antibody from antibodies-online
Targeting: MTMR12
3-PAP, 3PAP, FLJ20476, KIAA1682, PIP3AP
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503906 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myotubularin Related Protein 12 (MTMR12) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MTMR12 antibody: synthetic peptide directed towards the middle region of human MTMR12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDE
DDLAK REDEFVDLGD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of myotubularin as the lipid phosphatase catalytic subunit associated with the 3-phosphatase adapter protein, 3-PAP.
Nandurkar HH, Layton M, Laporte J, Selan C, Corcoran L, Caldwell KK, Mochizuki Y, Majerus PW, Mitchell CA
Proceedings of the National Academy of Sciences of the United States of America 2003 Jul 22;100(15):8660-5
Proceedings of the National Academy of Sciences of the United States of America 2003 Jul 22;100(15):8660-5
No comments: Submit comment
No validations: Submit validation data