HPA004332

FGFBP1 antibody from Sigma-Aldrich
FGFBP, HBP17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004332, RRID:AB_1078856
Product name
Anti-FGFBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004332
Antibody type
Polyclonal
Antigen
Fibroblast growth factor-binding protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQ
KDICRYSKTAVKTRVCRKDFPESSLKLVSSTLFGN
TKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATK
APECVEDPDMANQRKTALEFCGETWSSLCTFFL
Storage
-20C
Provider Type Product Number
- No reagents -