HPA014355

GJD2 antibody from Sigma-Aldrich
CX36, GJA9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014355, RRID:AB_1847141
Product name
Anti-GJD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014355
Antibody type
Polyclonal
Antigen
Gap junction delta-2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNF
GRTQSSDSAYV
Storage
-20C
Provider Type Product Number
- No reagents -