HPA014355

GJD2 antibody from Atlas Antibodies
CX36, GJA9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014355
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014355, RRID:AB_1847141
Product name
Anti-GJD2
Provider product page
Atlas Antibodies - HPA014355
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNF
GRTQSSDSAYV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -