HPA021667

SETD1B antibody from Atlas Antibodies
KIAA1076, KMT2G, Set1B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021667
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021667, RRID:AB_1856753
Product name
Anti-SETD1B
Provider product page
Atlas Antibodies - HPA021667
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVE
EPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARP
PLSPER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -