HPA021667

SETD1B antibody from Sigma-Aldrich
KIAA1076, KMT2G, Set1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021667, RRID:AB_1856753
Product name
Anti-SETD1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021667
Antibody type
Polyclonal
Antigen
Histone-lysine N-methyltransferase SETD1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVE
EPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARP
PLSPER
Storage
-20C
Provider Type Product Number
- No reagents -