ABIN629723

antibody from antibodies-online

Targeting: FBXL5 FBL4, FBL5, FLR1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629723 - Provider product page
Provider: antibodies-online
Product name: anti-F-Box and Leucine-Rich Repeat Protein 5 (FBXL5) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

FBXL5 protein structure - ABIN629723 shown in red.