HPA001849

TMOD3 antibody from Sigma-Aldrich
UTMOD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001849, RRID:AB_1080313
Product name
Anti-TMOD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001849
Antibody type
Polyclonal
Antigen
Tropomodulin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQT
FTEEKVSLDPELEEALTSASDTELCDLAAILGMHN
LITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVF
DEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIP
IPTLKD
Storage
-20C
Provider Type Product Number
- No reagents -