HPA019785

SLC22A15 antibody from Atlas Antibodies
FLIPT1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019785
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019785, RRID:AB_1857011
Product name
Anti-SLC22A15
Provider product page
Atlas Antibodies - HPA019785
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSL
THPANRSCRETGSFLDLFR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -