Antibody data

Product number
PAB21238
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21238, RRID:AB_10967537
Product name
SLC22A15 polyclonal antibody
Provider product page
Abnova Corporation - PAB21238
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC22A15.
Antigen sequence
ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSL
THPANRSCRETGSFLDLFR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -