Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004824-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004824-M02, RRID:AB_606664
- Product name
- NKX3-1 monoclonal antibody (M02), clone 1C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NKX3-1.
- Antigen sequence
GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHT
QVIELERKFSHQKYLSAPERAHLAKNLKLTETQVK
IWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEA
FSRAS- Isotype
- IgG
- Antibody clone number
- 1C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NKX3-1 monoclonal antibody (M02), clone 1C7 Western Blot analysis of NKX3-1 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NKX3-1 monoclonal antibody (M02), clone 1C7. Western Blot analysis of NKX3-1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NKX3-1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NKX3-1 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol