HPA025693

NKX3-1 antibody from Sigma-Aldrich
BAPX2, NKX3.1, NKX3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025693
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025693, RRID:AB_1854522
Product name
Anti-NKX3-1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025693
Antibody type
Polyclonal
Antigen
Homeobox protein Nkx-3.1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSL
PALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPA
Storage
-20C
Provider Type Product Number
- No reagents -