HPA005128

ENPEP antibody from Sigma-Aldrich
CD249, gp160
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005128, RRID:AB_1844795
Product name
Anti-ENPEP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005128
Antibody type
Polyclonal
Antigen
Glutamyl aminopeptidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFR
LPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSA
PTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFE
YKKQEYVVVE
Storage
-20C
Provider Type Product Number
- No reagents -