HPA024518

ZNF770 antibody from Sigma-Aldrich
FLJ20582, PRO1914
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024518
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024518, RRID:AB_1859449
Product name
Anti-ZNF770 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024518
Antibody type
Polyclonal
Antigen
Zinc finger protein 770 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPYASLCQVEFGNFNNLSNHSGNNVNYNASQQCQA
PGVQKYEVSESDQMSGVKAESQDFIPGSTGQPCLP
NVLLESEQSNPFCSYSEHQE
Storage
-20C
Provider Type Product Number
- No reagents -