HPA015322

ZNF532 antibody from MilliporeSigma / Merck KGaA
FLJ10697
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015322
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015322, RRID:AB_2304947
Product name
Anti-ZNF532 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015322
Antibody type
Polyclonal
Antigen
Zinc finger protein 532 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRTFTKRLMLEKHVQLMHGIKDPDLKEMTDATNEE
ETEIKEDTKVPSPKRKLEEPVLEFRPPRGAITQPL
KKLKINVFKVHKCAVCGFTTENLLQFHEHIPQHKS
DGSS
Storage
-20C
Provider Type Product Number
- No reagents -