Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183773 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger RNA Binding Protein (ZFR) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFR antibody: synthetic peptide directed towards the C terminal of human ZFR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDG
FEAEG KKDKKDYDNF- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The endogenous peptides of normal human serum extracted from the acetonitrile-insoluble precipitate using modified aqueous buffer with analysis by LC-ESI-Paul ion trap and Qq-TOF.
Tucholska M, Florentinus A, Williams D, Marshall JG
Journal of proteomics 2010 Apr 18;73(6):1254-69
Journal of proteomics 2010 Apr 18;73(6):1254-69
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting