HPA016666

ZFR antibody from Sigma-Aldrich
SPG71, ZFR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016666
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016666, RRID:AB_1859060
Product name
Anti-ZFR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016666
Antibody type
Polyclonal
Antigen
Zinc finger RNA-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NCTVNTSSIATSSMKGLTTTGNSSLNSTSNTKVSA
VPTNMAAKKTSTPKINFVGGNKLQSTGNKAEDIKG
TECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAAL
QSDVQPV
Storage
-20C
Provider Type Product Number
- No reagents -