HPA023918

STC1 antibody from Sigma-Aldrich
STC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023918
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023918, RRID:AB_1857566
Product name
Anti-STC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023918
Antibody type
Polyclonal
Antigen
Stanniocalcin-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGA
FACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAF
VKESL
Storage
-20C
Provider Type Product Number
- No reagents -