HPA024150

AGBL3 antibody from Atlas Antibodies
CCP3, MGC32955
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024150, RRID:AB_1844639
Product name
Anti-AGBL3
Provider product page
Atlas Antibodies - HPA024150
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DYSDRTISDEDESDEDMFMKFVSEDLHRCALLTAD
SFGDPFFPRTTQILLEYQLGRWVPRLREPRDLYGV
SSSGPLSPTRWPYHCEVIDE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -