HPA020397

AGBL3 antibody from Sigma-Aldrich
CCP3, MGC32955
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020397
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020397, RRID:AB_2242453
Product name
Anti-AGBL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020397
Antibody type
Polyclonal
Antigen
Cytosolic carboxypeptidase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CPEPVYIPTGLETQPLYPDSKEATVVYLAEDAYKE
PCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESG
NLQKVVKVAEYEY
Storage
-20C
Provider Type Product Number
- No reagents -