HPA004331

CYP4B1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004331
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004331, RRID:AB_1078616
Product name
Anti-CYP4B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004331
Antibody type
Polyclonal
Antigen
Cytochrome P450 4B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPD
YAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPK
WLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKW
EEKAREGKSFDIFCDVGH
Storage
-20C
Provider Type Product Number
- No reagents -