HPA022139

METTL23 antibody from Sigma-Aldrich
C17orf95, LOC124512
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022139
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022139, RRID:AB_1845608
Product name
Anti-C17orf95 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022139
Antibody type
Polyclonal
Antigen
UPF0563 protein C17orf95 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FCACESLSPCSGLSSLAARQGYHQIWAFPFLPSGA
TATWPAASRSRSLAARSLPRSPARPGPNDALL
Storage
-20C
Provider Type Product Number
- No reagents -