HPA023084

MLXIP antibody from Atlas Antibodies
bHLHe36, KIAA0867, MIR, MONDOA

Antibody data

Product number
HPA023084
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023084, RRID:AB_1854005
Product name
Anti-MLXIP
Provider product page
Atlas Antibodies - HPA023084
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSS
ILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQV
PLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSP
QSPQNNCSGKSDPKNVAALKNRQMK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.