HPA023084

MLXIP antibody from Sigma-Aldrich
bHLHe36, KIAA0867, MIR, MONDOA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023084, RRID:AB_1854005
Product name
Anti-MLXIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023084
Antibody type
Polyclonal
Antigen
MLX-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSS
ILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQV
PLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSP
QSPQNNCSGKSDPKNVAALKNRQMK
Storage
-20C
Provider Type Product Number
- No reagents -