HPA002561

EIF1AX antibody from Atlas Antibodies
eIF-1A, eIF-4C, EIF1A, EIF4C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002561
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002561, RRID:AB_1078724
Product name
Anti-EIF1AX
Provider product page
Atlas Antibodies - HPA002561
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKR
LCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVI
LKYNADEARSLKAYGELPEHAKINETDTFGPGDDD
EIQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -