Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001821 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001821, RRID:AB_1079806
- Product name
- Anti-RGS5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYN
EKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLA
SFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAE
KAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Antipsychotic Drug Clozapine Suppresses the RGS4 Polyubiquitylation and Proteasomal Degradation Mediated by the Arg/N-Degron Pathway
RGS5 decreases the proliferation of human ovarian carcinoma‑derived primary endothelial cells through the MAPK/ERK signaling pathway in hypoxia
Jeon J, Oh T, Park S, Huh S, Kim J, Mai B, Lee J, Kim S, Lee M
Neurotherapeutics 2021;18(3):1768-1782
Neurotherapeutics 2021;18(3):1768-1782
RGS5 decreases the proliferation of human ovarian carcinoma‑derived primary endothelial cells through the MAPK/ERK signaling pathway in hypoxia
Wang D, Xu Y, Feng L, Yin P, Song S, Wu F, Yan P, Liang Z
Oncology Reports 2018
Oncology Reports 2018
No comments: Submit comment
No validations: Submit validation data