HPA001821

RGS5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001821
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001821, RRID:AB_1079806
Product name
Anti-RGS5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001821
Antibody type
Polyclonal
Antigen
Regulator of G-protein signaling 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYN
EKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLA
SFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAE
KAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEP
Storage
-20C
Provider Type Product Number
- No reagents -