HPA002652

SFRP2 antibody from Atlas Antibodies
FRP-2, SARP1, SDF-5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002652
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002652, RRID:AB_2732394
Product name
Anti-SFRP2
Provider product page
Atlas Antibodies - HPA002652
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIK
VKEITYINRDTKIILETKSKTIYKLNGVSERDLKK
SVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELV
ITSVKRWQKGQRE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -