HPA002652

SFRP2 antibody from Sigma-Aldrich
FRP-2, SARP1, SDF-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002652, RRID:AB_1079937
Product name
Anti-SFRP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002652
Antibody type
Polyclonal
Antigen
Secreted frizzled-related protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIK
VKEITYINRDTKIILETKSKTIYKLNGVSERDLKK
SVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELV
ITSVKRWQKGQRE
Storage
-20C
Provider Type Product Number
- No reagents -