HPA018893

NSD3 antibody from MilliporeSigma / Merck KGaA
FLJ20353, KMT3F, WHISTLE, WHSC1L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018893
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018893, RRID:AB_1858833
Product name
Anti-WHSC1L1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018893
Antibody type
Polyclonal
Antigen
Histone-lysine N-methyltransferase NSD3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEE
EPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCN
MSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGN
KTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATS
Storage
-20C
Provider Type Product Number
- No reagents -