HPA018893

NSD3 antibody from Atlas Antibodies
FLJ20353, KMT3F, WHISTLE, WHSC1L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018893
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018893, RRID:AB_1858833
Product name
Anti-NSD3
Provider product page
Atlas Antibodies - HPA018893
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEE
EPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCN
MSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGN
KTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -