HPA022132

CD38 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022132, RRID:AB_1846300
Product name
Anti-CD38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022132
Antibody type
Polyclonal
Antigen
ADP-ribosyl cyclase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPE
KVQTLEAWVIHGGREDSRDLCQDPTIKELESIISK
RNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Storage
-20C
Provider Type Product Number
- No reagents -