H00084909-B01P

AOPEP antibody from Abnova Corporation
AP-O, APO, C90RF3, C9orf3, FLJ14675

Antibody data

Product number
H00084909-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084909-B01P, RRID:AB_1571880
Product name
C9orf3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084909-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C9orf3 protein.
Antigen sequence
MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFE
SQVIEGTIVLFLEDGNRFKKQNSSIEEACQSESNK
ACKFGMPEPCHIPVTNARTFSSEMEYNDFAICSKG
EKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSE
DFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTRSPE
LTVVSEEFRNQIVRELVTLPANRWREQLDYYARCS
QAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIR
IWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRA
LFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAK
PTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMK
METWSSNDLATERPFSPSEANFRHVGVCSHMEYPC
RFQNASATTQEIIPHRVFAPVCLTGACQETLLRLI
PPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMAR
PSKDKTGHTSDSGASVIKHGLNPEKIFMQVHYLKG
YFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQ
DFLQMLLENIPEEKRLELSVENIYQDWLESSGIPK
PLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKR
KRREKEEVFEKLLPDQLVLLLEHLLEQKTLSPRTL
QSLQRTYHLQDQDAEVRHRWCELIVKHKFTKAYKS
VERFLQEDQAMGVYLYGELMVSEDARQQQLARRCF
ERTKEQMDRSSAQVVAEMLF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -