HPA004633

AOPEP antibody from Atlas Antibodies
AP-O, APO, C90RF3, C9orf3, FLJ14675
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004633
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004633, RRID:AB_1078362
Product name
Anti-C9orf3
Provider product page
Atlas Antibodies - HPA004633
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECSSWYYYVTMPMPASTFTIAVGCWTEMKMETWSS
NDLATERPFSPSEANFRHVGVCSHMEYPCRFQNAS
ATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSA
AHSVLGAHPFSRLDVLIVPANFPSLGMA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -