HPA005661

ADAMTS5 antibody from Atlas Antibodies
ADAMTS11, ADMP-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005661
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005661, RRID:AB_1078101
Product name
Anti-ADAMTS5
Provider product page
Atlas Antibodies - HPA005661
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERD
GSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSP
RSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAE
EEKGRVYGDGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -